PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g041891m
Common NameCISIN_1g041891mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 450aa    MW: 49870.7 Da    PI: 5.8014
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g041891mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2951.9e-90444422373
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl..fsevsPil 91 
                        ++lLl+cA a++s+d +laq++++ l++ asp gdp+qRl++ f++AL +r ++ ++++ + ++ s+t+   + + +++++l  ++++ P++
  orange1.1g041891m  44 EKLLLHCASALESNDVTLAQQVMWVLNNVASPVGDPNQRLTSSFLRALISRASKVCPTTLSNFNGSSTN---HRRLMSVTELagYVDLIPWH 132
                        689*********************************************************999999998...455555555566******** PP

               GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnv 180
                        +f++ + N+aI +a++g ++vHi+Df+i++++QWp+L++aLa+RpegppslRiT+  s  ++    + + ee+g rL +fA+  +vpfef+v
  orange1.1g041891m 133 RFGFCASNSAIFKAIQGYSKVHILDFSITHCMQWPTLIDALAKRPEGPPSLRITVPYSRPPVpplLNVSAEEVGLRLGNFAKFRDVPFEFKV 224
                        *******************************************************99977778899999*********************** PP

               GRAS 181 l...............vakrledl.............eleeLrvkpgEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvv 239
                        +                                    +++ L+++++Eal++n++  l +l+d+++   +      rd++L+l+k+l+P ++
  orange1.1g041891m 225 IddsssagdivmskleS------SssfhfesllshlsTPSILNLREDEALVINCQNWLRYLYDDEGRGINaqdasLRDAFLHLIKGLNPCIM 310
                        *9999999985444330......32232222233344556669999****************9987654444455899************** PP

               GRAS 240 vvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplse 331
                        +vv++++d++++s+  r++ +++y +  fd+le+ lp+es++r  +E+  +g +i+n+++ eg++r+er e+ +k ++r+++aGF ++p+ e
  orange1.1g041891m 311 IVVDEDSDLSASSLTSRIATCFNYLWIPFDALETFLPKESRQRLDYEAD-VGHKIENIISFEGFQRIERSESGSKLSQRMKNAGFFSLPFCE 401
                        *************************************************.****************************************** PP

               GRAS 332 kaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                        +++k++++ll +++  g+ ++ e++ l l+Wk+++ v+++aW
  orange1.1g041891m 402 ETVKEVRSLLDEHA-SGWGMKREEEMLALTWKGHNSVFATAW 442
                        **************.889999999****************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.81317424IPR005202Transcription factor GRAS
PfamPF035146.6E-8844442IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MKAELRANTS SISLQNPSLF NTGQSSIPGA LRGCLGSLDG ACIEKLLLHC ASALESNDVT  60
LAQQVMWVLN NVASPVGDPN QRLTSSFLRA LISRASKVCP TTLSNFNGSS TNHRRLMSVT  120
ELAGYVDLIP WHRFGFCASN SAIFKAIQGY SKVHILDFSI THCMQWPTLI DALAKRPEGP  180
PSLRITVPYS RPPVPPLLNV SAEEVGLRLG NFAKFRDVPF EFKVIDDSSS AGDIVMSKLE  240
SSSSFHFESL LSHLSTPSIL NLREDEALVI NCQNWLRYLY DDEGRGINAQ DASLRDAFLH  300
LIKGLNPCIM IVVDEDSDLS ASSLTSRIAT CFNYLWIPFD ALETFLPKES RQRLDYEADV  360
GHKIENIISF EGFQRIERSE SGSKLSQRMK NAGFFSLPFC EETVKEVRSL LDEHASGWGM  420
KREEEMLALT WKGHNSVFAT AWVPNGLED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-23414422374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447452.10.0hypothetical protein CICLE_v10015222mg
RefseqXP_006469739.10.0PREDICTED: scarecrow-like protein 32
TrEMBLA0A067DY510.0A0A067DY51_CITSI; Uncharacterized protein
STRINGPOPTR_0017s06900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17642910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-126GRAS family protein